PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g35463.1.p
Common NameBRADI_2g35463
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 422aa    MW: 45293.4 Da    PI: 6.4506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g35463.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding635.8e-20106152148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT+eEd+ l+ av+q+G + W++Ia++++ gR +kqc++rw ++l
  Bradi2g35463.1.p 106 KGTWTKEEDDMLKAAVNQHGERKWALIAKHLP-GRIGKQCRERWINHL 152
                       799*****************************.************996 PP

2Myb_DNA-binding52.21.4e-16158200145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +++W++ Ed+ lv+a+k  G++ W+ Iar+++ gR+++++k++w+
  Bradi2g35463.1.p 158 KDPWSEAEDLELVNAHKICGNK-WSVIARRLP-GRSENNVKNHWN 200
                       689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.566101156IPR017930Myb domain
SMARTSM007173.6E-19105154IPR001005SANT/Myb domain
SuperFamilySSF466892.36E-30105199IPR009057Homeodomain-like
PfamPF002492.3E-18106152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-27107159IPR009057Homeodomain-like
CDDcd001671.14E-17108152No hitNo description
SMARTSM007171.3E-13157205IPR001005SANT/Myb domain
PROSITE profilePS5129416.976157207IPR017930Myb domain
PfamPF002492.5E-14158200IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-19160202IPR009057Homeodomain-like
CDDcd001676.20E-12160200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MAAGNEFFMD LELAAAMDRA VAGNYNYFNL ASSGLGGGVS AAQFFPINPA AQAHAGSAAH  60
GGHGAMAAPA TFGFGFGGGA LPVAAVAAPA PPLPPPAAAE DVEQLKGTWT KEEDDMLKAA  120
VNQHGERKWA LIAKHLPGRI GKQCRERWIN HLHPDIKKDP WSEAEDLELV NAHKICGNKW  180
SVIARRLPGR SENNVKNHWN ATRRGLNAKR SLKKRSSERQ PAPGRLSYLA HYIKTIHPPP  240
PSSTAASLSP PPPPEQENEE QQLQAPQVDA VEEEQDPAAG NGENSGSPTG MLGDEFSYYF  300
THMQVPQQQV QQRQMMNYNI SYNNVYPLLT AEDYQMGLNR TYAQQQVAQD RGSSSNNARL  360
DGVLMGNNAV GGGGFSSYGY GGGVGPSSVA GQEVNVAQFA AEPGQYQVFN LEDHLTRFPS  420
I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-391052026103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3J3W10.0A0A0Q3J3W1_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.13e-44myb domain protein 119